Recombinant Pasteurella multocida  Protein-export membrane protein SecG(secG)

Recombinant Pasteurella multocida Protein-export membrane protein SecG(secG)

CSB-CF871854ESG
Regular price
$1,084.00 USD
Sale price
$1,084.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pasteurella multocida (strain Pm70)

Uniprot NO.:Q9CP52

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYQTLLLGYAIIAIVIVFLILIQQGKGADAGASFGGGASGTIFGSVGSGNFLSKMTALLA TAFFVMSIVIGNVNSHRNNVKQGKFDDLSATAEQIQQQQKIDAPAVETKNSDIPQ

Protein Names:Recommended name: Protein-export membrane protein SecG

Gene Names:Name:secG Ordered Locus Names:PM0208

Expression Region:1-115

Sequence Info:full length protein