Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Parana virus (isolate Rat/Paraguay/12056/1965) (PARV)
Uniprot NO.:Q8B120
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GFFTWDISDSSGRHVPGGYCLEQWALVWAGIKCFDNSVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNTENSINLLKRSINGLISDSLVIRNSLKQLARIPYCNYTKFWYVNDTITKR HSLPQCWLTYNGSYLNETHFRNDWLLESQQLYNDMLVKEYEERQGKTPIALTDICFWSLV YFTVSVFLQLVGIPSHRHIVGQGCPKPHRISRNGLCSCGYYNIPMKPVRWVRKGK
Protein Names:Recommended name: Pre-glycoprotein polyprotein GP complex Cleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2 Short name= 6. GP2
Gene Names:Name:GPC Synonyms:GP-C
Expression Region:273-507
Sequence Info:full length protein