Recombinant Parana virus  Pre-glycoprotein polyprotein GP complex(GPC)

Recombinant Parana virus Pre-glycoprotein polyprotein GP complex(GPC)

CSB-CF803835ERX
Regular price
$1,178.00 USD
Sale price
$1,178.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Parana virus (isolate Rat/Paraguay/12056/1965) (PARV)

Uniprot NO.:Q8B120

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GFFTWDISDSSGRHVPGGYCLEQWALVWAGIKCFDNSVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNTENSINLLKRSINGLISDSLVIRNSLKQLARIPYCNYTKFWYVNDTITKR HSLPQCWLTYNGSYLNETHFRNDWLLESQQLYNDMLVKEYEERQGKTPIALTDICFWSLV YFTVSVFLQLVGIPSHRHIVGQGCPKPHRISRNGLCSCGYYNIPMKPVRWVRKGK

Protein Names:Recommended name: Pre-glycoprotein polyprotein GP complex Cleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2 Short name= 6. GP2

Gene Names:Name:GPC Synonyms:GP-C

Expression Region:273-507

Sequence Info:full length protein