
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Murine coronavirus (strain S) (MHV-S) (Murine hepatitis virus)
Uniprot NO.:P29075
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVLGPKATLAAVFIGPFIVACMLGIGLVYLLQLQVQIFHVKDTIRVTGKPATVSYTIST PVTPSATTLDGTTYTLIRPTSSYTRVYLGKTRGFDTSTFGPKVLDYITSSKPHLNSGRPY SLSC
Protein Names:Recommended name: Non-structural protein 4 Short name= ns4 Alternative name(s): Accessory protein 4
Gene Names:ORF Names:4
Expression Region:1-124
Sequence Info:full length protein