Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q3TB92
Gene Names: Milr1
Organism: Mus musculus (Mouse)
AA Sequence: ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS
Expression Region: 34-150aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 20.1 kDa
Alternative Name(s): Allergy inhibitory receptor 1 Mast cell antigen 32 Short name: MCA-32 Short name: Mast cell Ag-32 Mast cell immunoglobulin-like receptor 1 Gm885, Mca32
Relevance: Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
Reference: "An immunoglobulin-like receptor, Allergin-1, inhibits immunoglobulin E-mediated immediate hypersensitivity reactions." Hitomi K., Tahara-Hanaoka S., Someya S., Fujiki A., Tada H., Sugiyama T., Shibayama S., Shibuya K., Shibuya A. Nat. Immunol. 11:601-607(2010)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.