Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Uniprot NO.:A0AKH0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKMLVEFRDFALKGNVLDLAVAVVIGAAFGKIVSSLVDNIIMPVVGVLLGGLDFTKLSV TVGKSVIQYGAFIQSIVDFIIIAFAIFIFVKILTSFMKKKEQPVEETPVPPTEEYLKEIR DLLKEQQKEI
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:lwe2084
Expression Region:1-130
Sequence Info:full length protein