Recombinant Human Uncharacterized protein C19orf48(C19orf48)

Recombinant Human Uncharacterized protein C19orf48(C19orf48)

CSB-EP740850HU
Regular price
$540.00 USD
Sale price
$540.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q6RUI8

Gene Names: C19orf48

Organism: Homo sapiens (Human)

AA Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV

Expression Region: 1-117aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40.1 kDa

Alternative Name(s): Multidrug resistance-related protein

Relevance:

Reference: "[Cloning and sequence analysis of a new, full-length cDNA fragment of drug resistance-related gene in human lung adenocarcinoma]." Zhou X.D., Liu L.Z., Qian G.S., Huang G.J., Chen J. Ai Zheng 21:341-345(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.