Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tubulin-specific chaperone cofactor E-like protein(TBCEL)

Recombinant Human Tubulin-specific chaperone cofactor E-like protein(TBCEL)

SKU:CSB-EP722183HU

Regular price $857.00 USD
Regular price Sale price $857.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q5QJ74

Gene Names: TBCEL

Organism: Homo sapiens (Human)

AA Sequence: MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Expression Region: 1-424aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 64.2 kDa

Alternative Name(s): Leucine-rich repeat-containing protein 35

Relevance: Acts as a regulator of tubulin stability.

Reference: Identification of a novel tubulin-destabilizing protein related to the chaperone cofactor E.Bartolini F., Tian G., Piehl M., Cassimeris L., Lewis S.A., Cowan N.J.J. Cell Sci. 118:1197-1207(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details