
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P35270
Gene Names: SPR
Organism: Homo sapiens (Human)
AA Sequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Expression Region: 1-261aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 32 kDa
Alternative Name(s):
Relevance: Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Reference: "Detection of a novel sepiapterin reductase mRNA: assay of mRNA in various cells and tissues of various species." Maier J., Schott K., Werner T., Bacher A., Ziegler I. Exp. Cell Res. 204:217-222(1993)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human WD repeat-containing protein 38(WDR38)
- Regular price
- $858.00 USD
- Sale price
- $858.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human N-myc proto-oncogene protein(MYCN)
- Regular price
- $846.00 USD
- Sale price
- $846.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human COP9 signalosome complex subunit 2(COPS2)
- Regular price
- $1,101.00 USD
- Sale price
- $1,101.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Selenoprotein P(SEPP1)
- Regular price
- $846.00 USD
- Sale price
- $846.00 USD
- Regular price
-
- Unit price
- per
Sold out