Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Tags & Cell Markers
Uniprot ID: Q9UDW1
Gene Names: UQCR10
Organism: Homo sapiens (Human)
AA Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Expression Region: 1-63aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 34.2 kDa
Alternative Name(s): Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein
Relevance: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1
Reference: "Ubiquinol-cytochrome-c reductase from human and bovine mitochondria." Schaegger H., Brandt U., Gencic S., von Jagow G. Methods Enzymol. 260:82-96(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.