Recombinant Human Appetite-regulating hormone(GHRL)

Recombinant Human Appetite-regulating hormone(GHRL)

CSB-EP871388HU
Regular price
$534.00 USD
Sale price
$534.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: Q9UBU3

Gene Names: GHRL

Organism: Homo sapiens (Human)

AA Sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Expression Region: 1-117aa

Sequence Info: Full Length of BC025791

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.9 kDa

Alternative Name(s): Growth hormone secretagogue Growth hormone-releasing peptide Motilin-related peptide Protein M46

Relevance: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation. Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility

Reference: "Ghrelin is a growth-hormone-releasing acylated peptide from stomach." Kojima M., Hosoda H., Date Y., Nakazato M., Matsuo H., Kangawa K. Nature 402:656-660(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.