Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Anionic trypsin-1(Prss1)

Recombinant Rat Anionic trypsin-1(Prss1)

SKU:CSB-EP018811RA

Regular price ¥140,500 JPY
Regular price Sale price ¥140,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P00762

Gene Names: Prss1

Organism: Rattus norvegicus (Rat)

AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Expression Region: 24-246aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.6 kDa

Alternative Name(s): Anionic trypsin IPretrypsinogen ISerine protease 1

Relevance:

Reference: Two similar but nonallelic rat pancreatic trypsinogens. Nucleotide sequences of the cloned cDNAs.MacDonald R.J., Stary S.J., Swift G.H.J. Biol. Chem. 257:9724-9732(1982)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details