{"product_id":"recombinant-human-cytotoxic-granule-associated-rna-binding-protein-tia1-tia1","title":"Recombinant Human Cytotoxic granule associated RNA binding protein TIA1 (TIA1)","description":"\u003cp\u003e\u003cb\u003eSize\u003c\/b\u003e: 100ug. Other sizes are also available. \u003c\/p\u003e\u003cp\u003e\u003cb\u003eActivity\u003c\/b\u003e: Not tested\u003c\/p\u003e\u003cp\u003e\u003cb\u003eResearch Areas\u003c\/b\u003e: Cell Biology\u003c\/p\u003e\u003cp\u003e\u003cb\u003eUniprot ID\u003c\/b\u003e: P31483\u003c\/p\u003e\u003cp\u003e\u003cb\u003eGene Names\u003c\/b\u003e: TIA1\u003c\/p\u003e\u003cp\u003e\u003cb\u003eAlternative Name(s)\u003c\/b\u003e: Nucleolysin TIA-1 isoform p40;RNA-binding protein TIA-1;T-cell-restricted intracellular antigen-1;TIA-1;p40-TIA-1\u003c\/p\u003e\u003cp\u003e\u003cb\u003eAbbreviation\u003c\/b\u003e: Recombinant Human TIA1 protein\u003c\/p\u003e\u003cp\u003e\u003cb\u003eOrganism\u003c\/b\u003e: Homo sapiens (Human)\u003c\/p\u003e\u003cp\u003e\u003cb\u003eSource\u003c\/b\u003e: Yeast\u003c\/p\u003e\u003cp\u003e\u003cb\u003eExpression Region\u003c\/b\u003e: 1-386aa\u003c\/p\u003e\u003cp\u003e\u003cb\u003eProtein Length\u003c\/b\u003e: Full Length\u003c\/p\u003e\u003cp\u003e\u003cb\u003eTag  Info\u003c\/b\u003e: C-terminal 6xHis-tagged\u003c\/p\u003e\u003cp\u003e\u003cb\u003eTarget Protein Sequence\u003c\/b\u003e: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ\u003c\/p\u003e\u003cp\u003e\u003cb\u003eMW\u003c\/b\u003e: 44.4 kDa\u003c\/p\u003e\u003cp\u003e\u003cb\u003ePurity\u003c\/b\u003e: Greater than 85% as determined by SDS-PAGE.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eEndotoxin\u003c\/b\u003e: Not test\u003c\/p\u003e\u003cp\u003e\u003cb\u003eBiological_Activity\u003c\/b\u003e: \u003c\/p\u003e\u003cp\u003e\u003cb\u003eForm\u003c\/b\u003e: Liquid or Lyophilized powder\u003c\/p\u003e\u003cp\u003e\u003cb\u003eBuffer\u003c\/b\u003e: If the delivery form is liquid, the default storage buffer is Tris\/PBS-based buffer, 5%-50% glycerol.\nIf the delivery form is lyophilized powder, the buffer before lyophilization is Tris\/PBS-based buffer, 6% Trehalose, pH 8.0.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eReconstitution\u003c\/b\u003e: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg\/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃\/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eStorage\u003c\/b\u003e: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. \nGenerally, the shelf life of liquid form is 6 months at -20℃\/-80℃. The shelf life of lyophilized form is 12 months at -20℃\/-80℃.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eNotes\u003c\/b\u003e: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eRelevance\u003c\/b\u003e: RNA-binding protein involved in the regulation of alternative pre-RNA splicing and mRNA translation by binding to uridine-rich (U-rich) RNA sequences. Binds to U-rich sequences immediately downstream from a 5' splice sites in a uridine-rich small nuclear ribonucleoprotein (U snRNP)-dependent fashion, thereby modulating alternative pre-RNA splicing. Preferably binds to the U-rich IAS1 sequence in a U1 snRNP-dependent manner; this binding is optimal if a 5' splice site is adjacent to IAS1. Activates the use of heterologous 5' splice sites; the activation depends on the intron sequence downstream from the 5' splice site, with a preference for a downstream U-rich sequence. By interacting with SNRPC\/U1-C, promotes recruitment and binding of spliceosomal U1 snRNP to 5' splice sites followed by U-rich sequences, thereby facilitating atypical 5' splice site recognition by U1 snRNP. Activates splicing of alternative exons with weak 5' splice sites followed by a U-rich stretch on its own pre-mRNA and on TIAR mRNA. Acts as a modulator of alternative splicing for the apoptotic FAS receptor, thereby promoting apoptosis. Binds to the 5' splice site region of FAS intron 5 to promote accumulation of transcripts that include exon 6 at the expense of transcripts in which exon 6 is skipped, thereby leading to the transcription of a membrane-bound apoptotic FAS receptor, which promotes apoptosis. Binds to a conserved AU-rich cis element in COL2A1 intron 2 and modulates alternative splicing of COL2A1 exon 2. Also binds to the equivalent AT-rich element in COL2A1 genomic DNA, and may thereby be involved in the regulation of transcription. Binds specifically to a polypyrimidine-rich controlling element (PCE) located between the weak 5' splice site and the intronic splicing silencer of CFTR mRNA to promote exon 9 inclusion, thereby antagonizing PTB1 and its role in exon skipping of CFTR exon 9. Involved in the repression of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs), including target ARE-bearing mRNAs encoding TNF and PTGS2. Also participates in the cellular response to environmental stress, by acting downstream of the stress-induced phosphorylation of EIF2S1\/EIF2A to promote the recruitment of untranslated mRNAs to cytoplasmic stress granules (SGs), leading to stress-induced translational arrest. Formation and recruitment to SGs is regulated by Zn(2+). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. ; [Isoform Short]:  Displays enhanced splicing regulatory activity compared with TIA isoform Long.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eReference\u003c\/b\u003e: \u003c\/p\u003e\u003cp\u003e\u003cb\u003eFunction\u003c\/b\u003e: \u003c\/p\u003e","brand":"GeneBio Systems","offers":[{"title":"Default Title","offer_id":47929994477668,"sku":"P31483","price":112500.0,"currency_code":"JPY","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0558\/8588\/9636\/files\/no_image_default_image-jpeg_bed4b90a-e8c4-4160-8464-e4a82dc38b0d.jpg?v=1771437452","url":"https:\/\/www.genebiosystems.com\/en-jp\/products\/recombinant-human-cytotoxic-granule-associated-rna-binding-protein-tia1-tia1","provider":"GeneBio ","version":"1.0","type":"link"}