Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Coagulation factor XI(F11),partial

Recombinant Human Coagulation factor XI(F11),partial

SKU:CSB-EP007916HU

Regular price ¥140,300 JPY
Regular price Sale price ¥140,300 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Cardiovascular

Target / Protein: F11

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P03951

AA Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR

Tag info: N-terminal 6xHis-tagged

Expression Region: 19-387aa

Protein length: Partial

MW: 45.2 kDa

Alternative Name(s): Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: Coagulation factor XIa heavy chain Coagulation factor XIa light chain

Relevance: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Reference: "Revisiting the molecular epidemiology of factor XI deficiency: nine new mutations and an original large 4qTer deletion in western Brittany (France)."Gueguen P., Chauvin A., Quemener-Redon S., Pan-Petesch B., Ferec C., Abgrall J.F., Le Marechal C.Thromb. Haemost. 107:44-50(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details