Gene Bio Systems
Recombinant Shigella phage SfII Bactoprenol-linked glucose translocase(gtrA)
Recombinant Shigella phage SfII Bactoprenol-linked glucose translocase(gtrA)
SKU:CSB-CF517753SZD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella phage SfII (Shigella flexneri bacteriophage II) (Bacteriophage SfII)
Uniprot NO.:O21942
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVAVSFSFFANARFTFKA STTAMRYMYYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISLVCGFVYSKFIVFRDAK
Protein Names:Recommended name: Bactoprenol-linked glucose translocase
Gene Names:Name:gtrA
Expression Region:1-120
Sequence Info:full length protein
