Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shigella phage SfII Bactoprenol-linked glucose translocase(gtrA)

Recombinant Shigella phage SfII Bactoprenol-linked glucose translocase(gtrA)

SKU:CSB-CF517753SZD

Regular price €1.403,95 EUR
Regular price Sale price €1.403,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella phage SfII (Shigella flexneri bacteriophage II) (Bacteriophage SfII)

Uniprot NO.:O21942

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVAVSFSFFANARFTFKA STTAMRYMYYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISLVCGFVYSKFIVFRDAK

Protein Names:Recommended name: Bactoprenol-linked glucose translocase

Gene Names:Name:gtrA

Expression Region:1-120

Sequence Info:full length protein

View full details