Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF19(ORF19)

Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF19(ORF19)

SKU:CSB-CF311448IAD

Regular price €1.478,95 EUR
Regular price Sale price €1.478,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus)

Uniprot NO.:Q00136

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METMGPMVKSIWFWVIVLLVSGEGTDAVEIYWLELHESAVPCYGSKNTTMGDCLLAGGIL GLCGFEMLHRDTPLRRGVINKVSYRAVPRFMVFLSVMVTILHVLIITACLTIYIIAKVRS RCRRPIERTPDKPDPERVRLYLDSVRRRYWPCSGTEGDEDRTRLMPPGDRVEYDGREKLV RFSDVVTTHLLTDPGDGTYTIANE

Protein Names:Recommended name: Putative membrane protein ORF19

Gene Names:Name:ORF19

Expression Region:1-204

Sequence Info:full length protein

View full details