{"product_id":"recombinant-human-beta-defensin-124-defb124","title":"Recombinant Human Beta-defensin 124 (DEFB124)","description":"\u003cp\u003e\u003cb\u003eSize\u003c\/b\u003e: 100ug. Other sizes are also available. \u003c\/p\u003e\u003cp\u003e\u003cb\u003eActivity\u003c\/b\u003e: Not tested\u003c\/p\u003e\u003cp\u003e\u003cb\u003eResearch Areas\u003c\/b\u003e: Others\u003c\/p\u003e\u003cp\u003e\u003cb\u003eUniprot ID\u003c\/b\u003e: Q8NES8\u003c\/p\u003e\u003cp\u003e\u003cb\u003eGene Names\u003c\/b\u003e: DEFB124\u003c\/p\u003e\u003cp\u003e\u003cb\u003eAlternative Name(s)\u003c\/b\u003e: Beta-defensin 24 ;DEFB-24Defensin, beta 124\u003c\/p\u003e\u003cp\u003e\u003cb\u003eAbbreviation\u003c\/b\u003e: Recombinant Human DEFB124 protein\u003c\/p\u003e\u003cp\u003e\u003cb\u003eOrganism\u003c\/b\u003e: Homo sapiens (Human)\u003c\/p\u003e\u003cp\u003e\u003cb\u003eSource\u003c\/b\u003e: Yeast\u003c\/p\u003e\u003cp\u003e\u003cb\u003eExpression Region\u003c\/b\u003e: 23-71aa\u003c\/p\u003e\u003cp\u003e\u003cb\u003eProtein Length\u003c\/b\u003e: Full Length of Mature Protein\u003c\/p\u003e\u003cp\u003e\u003cb\u003eTag  Info\u003c\/b\u003e: N-terminal 6xHis-tagged\u003c\/p\u003e\u003cp\u003e\u003cb\u003eTarget Protein Sequence\u003c\/b\u003e: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE\u003c\/p\u003e\u003cp\u003e\u003cb\u003eMW\u003c\/b\u003e: 7.7 kDa\u003c\/p\u003e\u003cp\u003e\u003cb\u003ePurity\u003c\/b\u003e: Greater than 90% as determined by SDS-PAGE.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eEndotoxin\u003c\/b\u003e: Not test\u003c\/p\u003e\u003cp\u003e\u003cb\u003eBiological_Activity\u003c\/b\u003e: \u003c\/p\u003e\u003cp\u003e\u003cb\u003eForm\u003c\/b\u003e: Liquid or Lyophilized powder\u003c\/p\u003e\u003cp\u003e\u003cb\u003eBuffer\u003c\/b\u003e: If the delivery form is liquid, the default storage buffer is Tris\/PBS-based buffer, 5%-50% glycerol.\nIf the delivery form is lyophilized powder, the buffer before lyophilization is Tris\/PBS-based buffer, 6% Trehalose, pH 8.0.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eReconstitution\u003c\/b\u003e: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg\/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃\/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eStorage\u003c\/b\u003e: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. \nGenerally, the shelf life of liquid form is 6 months at -20℃\/-80℃. The shelf life of lyophilized form is 12 months at -20℃\/-80℃.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eNotes\u003c\/b\u003e: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.\u003c\/p\u003e\u003cp\u003e\u003cb\u003eRelevance\u003c\/b\u003e: Has antibacterial activity.Curated\u003c\/p\u003e\u003cp\u003e\u003cb\u003eReference\u003c\/b\u003e: The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.  , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414: 865-871(2001)\u003c\/p\u003e\u003cp\u003e\u003cb\u003eFunction\u003c\/b\u003e: Has antibacterial activity.\u003c\/p\u003e","brand":"GeneBio Systems","offers":[{"title":"Default Title","offer_id":47751775682660,"sku":"Q8NES8","price":546.95,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0558\/8588\/9636\/files\/no_image_default_image-jpeg_d600438d-e484-455c-bc77-f0cb4802c700.jpg?v=1769110236","url":"https:\/\/www.genebiosystems.com\/en-fr\/products\/recombinant-human-beta-defensin-124-defb124","provider":"GeneBio ","version":"1.0","type":"link"}