Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacillus kaustophilus UPF0295 protein GK0479(GK0479)

Recombinant Geobacillus kaustophilus UPF0295 protein GK0479(GK0479)

SKU:CSB-CF711512GAAA

Regular price €1.391,95 EUR
Regular price Sale price €1.391,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacillus kaustophilus (strain HTA426)

Uniprot NO.:Q5L2R6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSSKINKIRTFALSLIFIGVIVMYLGLFFRTSPVIMTLFMLFGMLFLVASGIVYFW IGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKS

Protein Names:Recommended name: UPF0295 protein GK0479

Gene Names:Ordered Locus Names:GK0479

Expression Region:1-117

Sequence Info:full length protein

View full details