Gene Bio Systems
Recombinant Drosophila erecta Protein anon-73B1(GG13569)
Recombinant Drosophila erecta Protein anon-73B1(GG13569)
SKU:CSB-CF871358DLK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila erecta (Fruit fly)
Uniprot NO.:Q9U5Y0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSASADSLAAAASLDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLMENNPDVNSNPET GEVTEREGEPVRTRLHKIRKLEKKKRR
Protein Names:Recommended name: Protein anon-73B1
Gene Names:ORF Names:GG13569
Expression Region:1-87
Sequence Info:full length protein
