Gene Bio Systems
Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF7(ORF7)
Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF7(ORF7)
SKU:CSB-CF803396SGAH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Spiroplasma virus SpV1-C74 (SpV1)
Uniprot NO.:Q88422
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGMYLTTAFNFLTAPTPKTMTEGMTGIWTGLTSALWKVKEGITNIFPEIMVFLGEAWII LIPFAIFCIIKILNFFRVMVKGF
Protein Names:Recommended name: Uncharacterized protein ORF7
Gene Names:ORF Names:ORF7
Expression Region:1-83
Sequence Info:full length protein