Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Probable N-acetyltransferase CML2(Cml2)

Recombinant Rat Probable N-acetyltransferase CML2(Cml2)

SKU:CSB-CF306370RA

Regular price €1.501,95 EUR
Regular price Sale price €1.501,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P85118

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSW LLATVYSFLFLLCLRLIFWVSCRNYVAKCLQADLADITKSYLNAHGSFWVAESGGQVVGI VAALPVKEPPSGRKQLQLFRLSVSSQHRGQGIAKALVRIVLQFARDQGYTDVVLVTGNMQ YSAISLYQGMGFQKTGHYFVSIAKRLIGLSIFHFTYSLPSVWEPRM

Protein Names:Recommended name: Probable N-acetyltransferase CML2 EC= 2.3.1.- Alternative name(s): Camello-like protein 2

Gene Names:Name:Cml2

Expression Region:1-226

Sequence Info:full length protein

View full details