Recombinant Rat Beta-nerve growth factor(Ngf)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Beta-nerve growth factor(Ngf)

CSB-YP015779RA
Regular price
€634,95 EUR
Sale price
€634,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: P25427

Gene Names: Ngf

Organism: Rattus norvegicus (Rat)

AA Sequence: SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Expression Region: 122-241aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15.4 kDa

Alternative Name(s):

Relevance: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Reference: "Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary." Hallboeoek F., Ibanez C.F., Persson H. Neuron 6:845-858(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Beta-nerve growth factor(Ngf),Partial
    Regular price
    €636,95 EUR
    Sale price
    €636,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Pig Beta-nerve growth factor(NGF)
    Regular price
    €748,95 EUR
    Sale price
    €748,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial
    Regular price
    €636,95 EUR
    Sale price
    €636,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human NGF
    Regular price
    €398,95 EUR
    Sale price
    €398,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share