Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human L-lactate dehydrogenase C chain(LDHC)

Recombinant Human L-lactate dehydrogenase C chain(LDHC)

SKU:CSB-EP012844HU

Regular price €869,95 EUR
Regular price Sale price €869,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P07864

Gene Names: LDHC

Organism: Homo sapiens (Human)

AA Sequence: STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Expression Region: 2-332aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 52.2 kDa

Alternative Name(s): Cancer/testis antigen 32 Short name: CT32 LDH testis subunit LDH-X

Relevance: Possible role in sperm motility. (S)-lactate + NAD+ = pyruvate + NADH.

Reference: "Epitopes of human testis-specific lactate dehydrogenase deduced from a cDNA sequence."Millan J.L., Driscoll C.E., Goldberg E.Proc. Natl. Acad. Sci. U.S.A. 84:5311-5315(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details