Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease(nucB)

Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease(nucB)

SKU:CSB-YP337282BRJ

Regular price €1.094,95 EUR
Regular price Sale price €1.094,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P42983

Gene Names: nucB

Organism: Bacillus subtilis (strain 168)

AA Sequence: SYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Expression Region: 29-136aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: NO-tagged

MW: 12 kDa

Alternative Name(s):

Relevance: Degrades both double-stranded linear and covalently closed circular DNA. Likely to play a scavenging role in order to supply nutrients under starvation conditions.

Reference: "Systematic sequencing of the 283 kb 210 degrees-232 degrees region of the Bacillus subtilis genome containing the skin element and many sporulation genes." Mizuno M., Masuda S., Takemaru K., Hosono S., Sato T., Takeuchi M., Kobayashi Y. Microbiology 142:3103-3111(1996)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details